G gamma12 (GNG12) (NM_018841) Human Recombinant Protein

CAT#: TP303268

Recombinant protein of human guanine nucleotide binding protein (G protein), gamma 12 (GNG12)


  View other "GNG12" proteins (3)

USD 823.00

In Stock*

Size
    • 20 ug

Product Images

Frequently bought together (1)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00

Other products for "GNG12"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC203268 protein sequence
Red=Cloning site Green=Tags(s)

MSSKTASTNNIAQARRTVQQLRLEASIEGIKVSKASADLMSYCEEHARSDPLLIGIPTSENPFKDKKTCI
IL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 7.8 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_061329
Locus ID 55970
UniProt ID Q9UBI6
Cytogenetics 1p31.3
Refseq Size 4427
Refseq ORF 216
Summary Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome
Protein Pathways Chemokine signaling pathway, MAPK signaling pathway, Regulation of actin cytoskeleton

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.