C20orf114 (BPIFB1) (NM_033197) Human Recombinant Protein
CAT#: TP303281
Recombinant protein of human chromosome 20 open reading frame 114 (C20orf114)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203281 representing NM_033197
Red=Cloning site Green=Tags(s) MAGPWTFTLLCGLLAATLIQATLSPTAVLILGPKVIKEKLTQELKDHNATSILQQLPLLSAMREKPAGGI PVLGSLVNTVLKHIIWLKVITANILQLQVKPSANDQELLVKIPLDMVAGFNTPLVKTIVEFHMTTEAQAT IRMDTSASGPTRLVLSDCATSHGSLRIQLLHKLSFLVNALAKQVMNLLVPSLPNLVKNQLCPVIEASFNG MYADLLQLVKVPISLSIDRLEFDLLYPAIKGDTIQLYLGAKLLDSQGKVTKWFNNSAASLTMPTLDNIPF SLIVSQDVVKAAVAAVLSPEEFMVLLDSVLPESAHRLKSSIGLINEKAADKLGSTQIVKILTQDTPEFFI DQGHAKVAQLIVLEVFPSSEALRPLFTLGIEASSEAQFYTKGDQLILNLNNISSDRIQLMNSGIGWFQPD VLKNIITEIIHSILLPNQNGKLRSGVPVSLVKALGFEAAESSLTKDALVLTPASLWKPSSPVSQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 50.2 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_149974 |
Locus ID | 92747 |
UniProt ID | Q8TDL5 |
Cytogenetics | 20q11.21 |
Refseq Size | 1734 |
Refseq ORF | 1452 |
Synonyms | C20orf114; LPLUNC1 |
Summary | The protein encoded by this gene may be involved in the innate immune response to bacterial exposure in the mouth, nasal cavities, and lungs. The encoded protein is secreted and is a member of the BPI/LBP/PLUNC protein superfamily. This gene is found with other members of the superfamily in a cluster on chromosome 20. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409675 | BPIFB1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY409675 | Transient overexpression lysate of chromosome 20 open reading frame 114 (C20orf114) |
USD 325.00 |
|
PH303281 | C20orf114 MS Standard C13 and N15-labeled recombinant protein (NP_149974) |
USD 2,055.00 |
|
TP701097 | Purified recombinant protein of Human chromosome 20 open reading frame 114 (C20orf114), Thr22-End, with C-terminal His tag, secretory expressed in HEK293 cells, 50 ug |
USD 788.00 |
{0} Product Review(s)
Be the first one to submit a review