RHOA (NM_001664) Human Recombinant Protein

CAT#: TP303303

Recombinant protein of human ras homolog gene family, member A (RHOA)


  View other "RHOA" proteins (3)

USD 823.00

In Stock*

Size
    • 20 ug

Product Images

Frequently bought together (2)
Anti-RHOA Rabbit Polyclonal Antibody
    • 100 ul

USD 345.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00

Other products for "RHOA"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC203303 protein sequence
Red=Cloning site Green=Tags(s)

MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLR
PLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVK
PEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 21.6 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001655
Locus ID 387
UniProt ID P61586, A0A024R324, Q9BVT0
Cytogenetics 3p21.31
Refseq Size 1926
Refseq ORF 579
Synonyms ARH12; ARHA; EDFAOB; RHO12; RHOH12
Summary This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants have been identified. [provided by RefSeq, Sep 2015]
Protein Families Druggable Genome
Protein Pathways Adherens junction, Axon guidance, Chemokine signaling pathway, Focal adhesion, Leukocyte transendothelial migration, Neurotrophin signaling pathway, Pathogenic Escherichia coli infection, Pathways in cancer, Regulation of actin cytoskeleton, T cell receptor signaling pathway, TGF-beta signaling pathway, Tight junction, Vascular smooth muscle contraction, Wnt signaling pathway

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.