CISD1 (NM_018464) Human Recombinant Protein

CAT#: TP303308

Recombinant protein of human CDGSH iron sulfur domain 1 (CISD1)

Product Images

Coomassie blue staining of purified CISD1 protein (Cat# TP303308). The protein was produced from HEK293T cells transfected with CISD1 cDNA clone (Cat# RC203308) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203308 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSLTSSSSVRVEWIAAVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAV
  YCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 12 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_060934
• Locus ID: 55847
• UniProt ID: Q9NZ45, A0A024QZN7
• Cytogenetics: 10q21.1
• Refseq Size: 2115
• Refseq ORF: 324
• Synonyms: C10orf70; MDS029; mitoNEET; ZCD1
• Summary: This gene encodes a protein with a CDGSH iron-sulfur domain and has been shown to bind a redox-active [2Fe-2S] cluster. The encoded protein has been localized to the outer membrane of mitochondria and is thought to play a role in regulation of oxidation. Genes encoding similar proteins are located on chromosomes 4 and 17, and a pseudogene of this gene is located on chromosome 2. [provided by RefSeq, Feb 2012]
• Protein Families: Transmembrane