TPMT (NM_000367) Human Recombinant Protein

CAT#: TP303309

Recombinant protein of human thiopurine S-methyltransferase (TPMT)

Product Images

Coomassie blue staining of purified TPMT protein (Cat# TP303309). The protein was produced from HEK293T cells transfected with TPMT cDNA clone (Cat# RC203309) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203309 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDGTRTSLDIEEYSDTEVQKNQVLTLEEWQDKWVNGKTAFHQEQGHQLLKKHLDTFLKGKSGLRVFFPLC
  GKAVEMKWFADRGHSVVGVEISELGIQEFFTEQNLSYSEEPITEIPGTKVFKSSSGNISLYCCSIFDLPR
  TNIGKFDMIWDRGALVAINPGDRKCYADTMFSLLGKKFQYLLCVLSYDPTKHPGPPFYVPHAEIERLFGK
  ICNIRCLEKVDAFEERHKSWGIDCLFEKLYLLTEK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 28 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_000358
• Locus ID: 7172
• UniProt ID: P51580, A0A024QZW0
• Cytogenetics: 6p22.3
• Refseq Size: 3281
• Refseq ORF: 735
• Synonyms: TPMTD
• Summary: This gene encodes the enzyme that metabolizes thiopurine drugs via S-adenosyl-L-methionine as the S-methyl donor and S-adenosyl-L-homocysteine as a byproduct. Thiopurine drugs such as 6-mercaptopurine are used as chemotherapeutic agents. Genetic polymorphisms that affect this enzymatic activity are correlated with variations in sensitivity and toxicity to such drugs within individuals, causing thiopurine S-methyltransferase deficiency. Related pseudogenes have been identified on chromosomes 3, 18 and X. [provided by RefSeq, Aug 2014]
• Protein Families: Druggable Genome
• Protein Pathways: Drug metabolism - other enzymes