ATP6J (ATP6V1G1) (NM_004888) Human Recombinant Protein
CAT#: TP303317
Recombinant protein of human ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G1 (ATP6V1G1)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203317 protein sequence
Red=Cloning site Green=Tags(s) MASQSQGIQQLLQAEKRAAEKVSEARKRKNRRLKQAKEEAQAEIEQYRLQREKEFKAKEAAALGSRGSCS TEVEKETQEKMTILQTYFRQNRDEVLDNLLAFVCDIRPEIHENYRING myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 13.6 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004879 |
Locus ID | 9550 |
UniProt ID | O75348, A0A024R883 |
Cytogenetics | 9q32 |
Refseq Size | 1611 |
Refseq ORF | 354 |
Synonyms | ATP6G; ATP6G1; ATP6GL; ATP6J; Vma10 |
Summary | This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. The protein encoded by this gene is one of three V1 domain G subunit proteins. Pseudogenes of this gene have been characterized. [provided by RefSeq, Jul 2008] |
Protein Pathways | Epithelial cell signaling in Helicobacter pylori infection, Metabolic pathways, Oxidative phosphorylation, Vibrio cholerae infection |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417674 | ATP6V1G1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY417674 | Transient overexpression lysate of ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G1 (ATP6V1G1) |
USD 325.00 |
|
PH303317 | ATP6V1G1 MS Standard C13 and N15-labeled recombinant protein (NP_004879) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review