XTP4 (MIEN1) (NM_032339) Human Recombinant Protein

CAT#: TP303346

Recombinant protein of human chromosome 17 open reading frame 37 (C17orf37)

Product Images

Coomassie blue staining of purified MIEN1 protein (Cat# TP303346). The protein was produced from HEK293T cells transfected with MIEN1 cDNA clone (Cat# RC203346) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203346 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSGEPGQTSVAPPPEEVEPGSGVRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEIN
  GQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRPPCVIL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 12.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_115715
• Locus ID: 84299
• UniProt ID: Q9BRT3
• Cytogenetics: 17q12
• Refseq Size: 781
• Refseq ORF: 345
• Synonyms: C17orf37; C35; ORB3; RDX12; XTP4
• Summary: Increases cell migration by inducing filopodia formation at the leading edge of migrating cells. Plays a role in regulation of apoptosis, possibly through control of CASP3. May be involved in a redox-related process.[UniProtKB/Swiss-Prot Function]