ZNF447 (ZSCAN18) (NM_023926) Human Recombinant Protein
CAT#: TP303390
Purified recombinant protein of Homo sapiens zinc finger and SCAN domain containing 18 (ZSCAN18)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203390 protein sequence
Red=Cloning site Green=Tags(s) MLPLEKAFASPRSSPAPPDLPTPGSAAGVQQEEPETIPERTPADLEFSRLRFREFVYQEAAGPHQTLARL HELCRQWLMPEARSKEQMLELLVLEQFLGILPDKVRPWVVAQYPESCKKAASLVEGLADVLEEPGMLLGS PAGSSSILSDGVYERHMDPLLLPGELASPSQALGAGEIPAPSETPWLSPDPLFLEQRRVREAKTEEDGPA NTEQKLKSFPEDPQHLGEWGHLDPAEENLKSYRKLLLWGYQLSQPDAASRLDTEELRLVERDPQGSSLPE GGRRQESAGCACEEAAPAGVLPELPTEAPPGDALADPPSGTTEEEEEQPGKAPDPQDPQDAESDSATGSQ RQSVIQQPAPDRGTAKLGTKRPHPEDGDEQSLEGVSSSGDSAGLEAGQGPGADEPGLSRGKPYACGECGE AFAWLSHLMEHHSSHGGRKRYACQGCWKTFHFSLALAEHQKTHEKEKSYALGGARGPQPSTREAQAGARA GGPPESVEGEAPPAPPEAQR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 54.6 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_076415 |
Locus ID | 65982 |
UniProt ID | Q8TBC5, A0A024R4T0 |
Cytogenetics | 19q13.43 |
Refseq Size | 2960 |
Refseq ORF | 1530 |
Synonyms | ZNF447 |
Summary | May be involved in transcriptional regulation.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402961 | ZSCAN18 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC428933 | ZSCAN18 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC428934 | ZSCAN18 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402961 | Transient overexpression lysate of zinc finger and SCAN domain containing 18 (ZSCAN18), transcript variant 3 |
USD 396.00 |
|
LY428933 | Transient overexpression lysate of zinc finger and SCAN domain containing 18 (ZSCAN18), transcript variant 1 |
USD 396.00 |
|
LY428934 | Transient overexpression lysate of zinc finger and SCAN domain containing 18 (ZSCAN18), transcript variant 4 |
USD 396.00 |
|
PH303390 | ZSCAN18 MS Standard C13 and N15-labeled recombinant protein (NP_076415) |
USD 2,055.00 |
|
PH327637 | ZSCAN18 MS Standard C13 and N15-labeled recombinant protein (NP_001139015) |
USD 2,055.00 |
|
TP327637 | Recombinant protein of human zinc finger and SCAN domain containing 18 (ZSCAN18), transcript variant 4 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review