PNO1 (NM_020143) Human Recombinant Protein

CAT#: TP303434

Recombinant protein of human partner of NOB1 homolog (S. cerevisiae) (PNO1)

Product Images

Coomassie blue staining of purified PNO1 protein (Cat# TP303434). The protein was produced from HEK293T cells transfected with PNO1 cDNA clone (Cat# RC203434) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203434 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MESEMETQSARAEEGFTQVTRKGGRRAKKRQAEQLSAAGEGGDAGRMDTEEARPAKRPVFPPLCGDGLLS
  GKEETRKIPVPANRYTPLKENWMKIFTPIVEHLGLQIRFNLKSRNVEIRTCKETKDVSALTKAADFVKAF
  ILGFQVEDALALIRLDDLFLESFEITDVKPLKGDHLSRAIGRIAGKGGKTKFTIENVTRTRIVLADVKVH
  ILGSFQNIKMARTAICNLILGNPPSKVYGNIRAVASRSADRF
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 27.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_064528
• Locus ID: 56902
• UniProt ID: Q9NRX1
• Cytogenetics: 2p14
• Refseq Size: 1994
• Refseq ORF: 756
• Synonyms: KHRBP1; RRP20
• Summary: Positively regulates dimethylation of two adjacent adenosines in the loop of a conserved hairpin near the 3'-end of 18S rRNA (PubMed:25851604).[UniProtKB/Swiss-Prot Function]