SPINT1 (NM_001032367) Human Recombinant Protein
CAT#: TP303537
Recombinant protein of human serine peptidase inhibitor, Kunitz type 1 (SPINT1), transcript variant 3
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203537 protein sequence
Red=Cloning site Green=Tags(s) MAPARTMARARLAPAGIPAVALWLLCTLGLQGTQAGPPPAPPGLPAGADCLNSFTAGVPGFVLDTNASVS NGATFLESPTVRRGWDCVRACCTTQNCNLALVELQPDRGEDAIAACFLINCLYEQNFVCKFAPREGFINY LTREVYRSYRQLRTQGFGGSGIPKAWAGIDLKVQPQEPLVLKDVENTDWRLLRGDTDVRVERKDPNQVEL WGLKEGTYLFQLTVTSSDHPEDTANVTVTVLSTKQTEDYCLASNKVGRCRGSFPRWYYDPTEQICKSFVY GGCLGNKNNYLREEECILACRGVQGPSMERRHPVCSGTCQPTQFRCSNGCCIDSFLECDDTPNCPDASDE AACEKYTSGFDELQRIHFPSDKGHCVDLPDTGLCKESIPRWYYNPFSEHCARFTYGGCYGNKNNFEEEQQ CLESCRGISKKDVFGLRREIPIPSTGSVEMAVAVFLVICIVVVVAILGYCFFKNQRKDFHGHHHHPPPTP ASSTVSTTEDTEHLVYNHTTRPL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 53.3 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001027539 |
Locus ID | 6692 |
UniProt ID | O43278 |
Cytogenetics | 15q15.1 |
Refseq Size | 2342 |
Refseq ORF | 1539 |
Synonyms | HAI; HAI1; MANSC2 |
Summary | The protein encoded by this gene is a member of the Kunitz family of serine protease inhibitors. The protein is a potent inhibitor specific for HGF activator and is thought to be involved in the regulation of the proteolytic activation of HGF in injured tissues. Alternative splicing results in multiple variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405735 | SPINT1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC422310 | SPINT1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY405735 | Transient overexpression lysate of serine peptidase inhibitor, Kunitz type 1 (SPINT1), transcript variant 1 |
USD 495.00 |
|
LY422310 | Transient overexpression lysate of serine peptidase inhibitor, Kunitz type 1 (SPINT1), transcript variant 3 |
USD 325.00 |
|
PH303537 | SPINT1 MS Standard C13 and N15-labeled recombinant protein (NP_001027539) |
USD 2,055.00 |
|
PH318993 | SPINT1 MS Standard C13 and N15-labeled recombinant protein (NP_857593) |
USD 2,055.00 |
|
TP318993 | Recombinant protein of human serine peptidase inhibitor, Kunitz type 1 (SPINT1), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review