OTUD6B (NM_016023) Human Recombinant Protein

CAT#: TP303722

Recombinant protein of human OTU domain containing 6B (OTUD6B)

Product Images

Coomassie blue staining of purified OTUD6B protein (Cat# TP303722). The protein was produced from HEK293T cells transfected with OTUD6B cDNA clone (Cat# RC203722) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203722 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEAVLTEELDEEEQLLRRHRKEKKELQAKIQGMKNAVPKNDKKRRKQLTEDVAKLEKEMEQKHREELEQL
  KLTTKENKIDSVAVNISNLVLENQPPRISKAQKRREKKAALEKEREERIAEAEIENLTGARHMESEKLAQ
  ILAARQLEIKQIPSDGHCMYKAIEDQLKEKDCALTVVALRSQTAEYMQSHVEDFLPFLTNPNTGDMYTPE
  EFQKYCEDIVNTAAWGGQLELRALSHILQTPIEIIQADSPPIIVGEEYSKKPLILVYMRHAYGLGEHYNS
  VTRLVNIVTENCS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 37.1 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057107
• Locus ID: 51633
• UniProt ID: Q8N6M0, A0A087X0W9
• Cytogenetics: 8q21.3
• Refseq Size: 3306
• Refseq ORF: 879
• Synonyms: CGI-77; DUBA-5; DUBA5; IDDFSDA
• Summary: This gene encodes a member of the ovarian tumor domain (OTU)-containing subfamily of deubiquitinating enzymes. Deubiquitinating enzymes are primarily involved in removing ubiquitin from proteins targeted for degradation. This protein may function as a negative regulator of the cell cycle in B cells. [provided by RefSeq, Nov 2013]
• Protein Families: Protease