OTUD6B (NM_016023) Human Mass Spec Standard

CAT#: PH303722

OTUD6B MS Standard C13 and N15-labeled recombinant protein (NP_057107)

Product Images

Coomassie blue staining of purified OTUD6B protein (Cat# TP303722). The protein was produced from HEK293T cells transfected with OTUD6B cDNA clone (Cat# RC203722) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203722
• Predicted MW: 33.8 kDa
• Protein Sequence:
  Sequence Link

  >RC203722 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEAVLTEELDEEEQLLRRHRKEKKELQAKIQGMKNAVPKNDKKRRKQLTEDVAKLEKEMEQKHREELEQL
  KLTTKENKIDSVAVNISNLVLENQPPRISKAQKRREKKAALEKEREERIAEAEIENLTGARHMESEKLAQ
  ILAARQLEIKQIPSDGHCMYKAIEDQLKEKDCALTVVALRSQTAEYMQSHVEDFLPFLTNPNTGDMYTPE
  EFQKYCEDIVNTAAWGGQLELRALSHILQTPIEIIQADSPPIIVGEEYSKKPLILVYMRHAYGLGEHYNS
  VTRLVNIVTENCS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057107
• RefSeq Size: 3306
• RefSeq ORF: 879
• Synonyms: CGI-77; DUBA-5; DUBA5; IDDFSDA
• Locus ID: 51633
• UniProt ID: Q8N6M0, A0A087X0W9
• Cytogenetics: 8q21.3
• Summary: This gene encodes a member of the ovarian tumor domain (OTU)-containing subfamily of deubiquitinating enzymes. Deubiquitinating enzymes are primarily involved in removing ubiquitin from proteins targeted for degradation. This protein may function as a negative regulator of the cell cycle in B cells. [provided by RefSeq, Nov 2013]
• Protein Families: Protease