TIM 4 (TIMD4) (NM_138379) Human Recombinant Protein
CAT#: TP303848
Recombinant protein of human T-cell immunoglobulin and mucin domain containing 4 (TIMD4)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203848 protein sequence
Red=Cloning site Green=Tags(s) MSKEPLILWLMIEFWWLYLTPVTSETVVTEVLGHRVTLPCLYSSWSHNSNSMCWGKDQCPYSGCKEALIR TDGMRVTSRKSAKYRLQGTIPRGDVSLTILNPSESDSGVYCCRIEVPGWFNDVKINVRLNLQRASTTTHR TATTTTRRTTTTSPTTTRQMTTTPAALPTTVVTTPDLTTGTPLQMTTIAVFTTANTCLSLTPSTLPEEAT GLLTPEPSKEGPILTAESETVLPSDSWSSAESTSADTVLLTSKESKVWDLPSTSHVSMWKTSDSVSSPQP GASDTAVPEQNKTTKTGQMDGIPMSMKNEMPISQLLMIIAPSLGFVLFALFVAFLLRGKLMETYCSQKHT RLDYIGDSKNVLNDVQHGREDEDGLFTL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 41.4 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_612388 |
Locus ID | 91937 |
UniProt ID | Q96H15 |
Cytogenetics | 5q33.3 |
Refseq Size | 1374 |
Refseq ORF | 1134 |
Synonyms | SMUCKLER; TIM4 |
Summary | Phosphatidylserine receptor that enhances the engulfment of apoptotic cells. Involved in regulating T-cell proliferation and lymphotoxin signaling. Ligand for HAVCR1/TIMD1 (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408645 | TIMD4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC431308 | TIMD4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY408645 | Transient overexpression lysate of T-cell immunoglobulin and mucin domain containing 4 (TIMD4), transcript variant 1 |
USD 396.00 |
|
LY431308 | Transient overexpression lysate of T-cell immunoglobulin and mucin domain containing 4 (TIMD4), transcript variant 2 |
USD 396.00 |
|
PH303848 | TIMD4 MS Standard C13 and N15-labeled recombinant protein (NP_612388) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review