NCE2 (UBE2F) (NM_080678) Human Recombinant Protein
CAT#: TP303942
Recombinant protein of human ubiquitin-conjugating enzyme E2F (putative) (UBE2F)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203942 representing NM_080678
Red=Cloning site Green=Tags(s) MLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPNKLHCFQLTVT PDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVV WGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDYIKRYAR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.9 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_542409 |
Locus ID | 140739 |
UniProt ID | Q969M7 |
Cytogenetics | 2q37.3 |
Refseq Size | 1366 |
Refseq ORF | 555 |
Synonyms | NCE2 |
Summary | Accepts the ubiquitin-like protein NEDD8 from the UBA3-NAE1 E1 complex and catalyzes its covalent attachment to other proteins. The specific interaction with the E3 ubiquitin ligase RBX2, but not RBX1, suggests that the RBX2-UBE2F complex neddylates specific target proteins, such as CUL5.[UniProtKB/Swiss-Prot Function] |
Protein Pathways | Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409102 | UBE2F HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY409102 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2F (putative) (UBE2F) |
USD 325.00 |
|
PH303942 | UBE2F MS Standard C13 and N15-labeled recombinant protein (NP_542409) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review