NOSIP (NM_015953) Human Recombinant Protein

CAT#: TP304024

Recombinant protein of human nitric oxide synthase interacting protein (NOSIP)

Product Images

Coomassie blue staining of purified NOSIP protein (Cat# TP304024). The protein was produced from HEK293T cells transfected with NOSIP cDNA clone (Cat# RC204024) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204024 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAI
  LEYILHQKKEIARQMKAYEKQRGTRREEQKELQRAASQDHVRGFLEKESAIVSRPLNPFTAKALSGTSPD
  DVQPGPSVGPPSKDKDKVLPSFWIPSLTPEAKATKLEKPSRTVTCPMSGKPLRMSDLTPVHFTPLDSSVD
  RVGLITRSERYVCAVTRDSLSNATPCAVLRPSGAVVTLECVEKLIRKDMVDPVTGDKLTDRDIIVLQRGG
  TGFAGSGVKLQAEKSRPVMQA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 33 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057037
• Locus ID: 51070
• UniProt ID: Q9Y314
• Cytogenetics: 19q13.33
• Refseq Size: 1367
• Refseq ORF: 903
• Synonyms: CGI-25
• Summary: The protein encoded by this gene may modulate the activity and localization of nitric oxide synthase (endothelial and neuronal) and thus nitric oxide production. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Aug 2012]