NOSIP (NM_015953) Human Recombinant Protein
CAT#: TP304024
Recombinant protein of human nitric oxide synthase interacting protein (NOSIP)
View other "NOSIP" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204024 protein sequence
Red=Cloning site Green=Tags(s) MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAI LEYILHQKKEIARQMKAYEKQRGTRREEQKELQRAASQDHVRGFLEKESAIVSRPLNPFTAKALSGTSPD DVQPGPSVGPPSKDKDKVLPSFWIPSLTPEAKATKLEKPSRTVTCPMSGKPLRMSDLTPVHFTPLDSSVD RVGLITRSERYVCAVTRDSLSNATPCAVLRPSGAVVTLECVEKLIRKDMVDPVTGDKLTDRDIIVLQRGG TGFAGSGVKLQAEKSRPVMQA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057037 |
Locus ID | 51070 |
UniProt ID | Q9Y314 |
Cytogenetics | 19q13.33 |
Refseq Size | 1367 |
Refseq ORF | 903 |
Synonyms | CGI-25 |
Summary | The protein encoded by this gene may modulate the activity and localization of nitric oxide synthase (endothelial and neuronal) and thus nitric oxide production. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Aug 2012] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414305 | NOSIP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY414305 | Transient overexpression lysate of nitric oxide synthase interacting protein (NOSIP) |
USD 396.00 |
|
PH304024 | NOSIP MS Standard C13 and N15-labeled recombinant protein (NP_057037) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review