PGLS (NM_012088) Human Recombinant Protein

CAT#: TP304132

Recombinant protein of human 6-phosphogluconolactonase (PGLS)


  View other "PGLS" proteins (3)

USD 823.00

In Stock*

Size
    • 20 ug

Product Images

Frequently bought together (2)
Rabbit Polyclonal Anti-PGLS Antibody - middle region
    • 100 ul

USD 475.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00

Other products for "PGLS"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC204132 protein sequence
Red=Cloning site Green=Tags(s)

MAAPAPGLISVFSSSQELGAALAQLVAQRAACCLAGARARFALGLSGGSLVSMLARELPAAVAPAGPASL
ARWTLGFCDERLVPFDHAESTYGLYRTHLLSRLPIPESQVITINPELPVEEAAEDYAKKLRQAFQGDSIP
VFDLLILGVGPDGHTCSLFPDHPLLQEREKIVAPISDSPKPPPQRVTLTLPVLNAARTVIFVATGEGKAA
VLKRILEDQEENPLPAALVQPHTGKLCWFLDEAAARLLTVPFEKHSTL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 27.4 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_036220
Locus ID 25796
UniProt ID O95336, A0A0K0K1K7
Cytogenetics 19p13.11
Refseq Size 1043
Refseq ORF 774
Synonyms 6PGL; HEL-S-304
Summary Hydrolysis of 6-phosphogluconolactone to 6-phosphogluconate.[UniProtKB/Swiss-Prot Function]
Protein Pathways Metabolic pathways, Pentose phosphate pathway

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.