PGLS (NM_012088) Human Mass Spec Standard

CAT#: PH304132

PGLS MS Standard C13 and N15-labeled recombinant protein (NP_036220)

Product Images

Coomassie blue staining of purified PGLS protein (Cat# TP304132). The protein was produced from HEK293T cells transfected with PGLS cDNA clone (Cat# RC204132) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204132
• Predicted MW: 27.5 kDa
• Protein Sequence:
  Sequence Link

  >RC204132 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAPAPGLISVFSSSQELGAALAQLVAQRAACCLAGARARFALGLSGGSLVSMLARELPAAVAPAGPASL
  ARWTLGFCDERLVPFDHAESTYGLYRTHLLSRLPIPESQVITINPELPVEEAAEDYAKKLRQAFQGDSIP
  VFDLLILGVGPDGHTCSLFPDHPLLQEREKIVAPISDSPKPPPQRVTLTLPVLNAARTVIFVATGEGKAA
  VLKRILEDQEENPLPAALVQPHTGKLCWFLDEAAARLLTVPFEKHSTL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_036220
• RefSeq Size: 1043
• RefSeq ORF: 774
• Synonyms: 6PGL; HEL-S-304
• Locus ID: 25796
• UniProt ID: O95336, A0A0K0K1K7
• Cytogenetics: 19p13.11
• Summary: Hydrolysis of 6-phosphogluconolactone to 6-phosphogluconate. [UniProtKB/Swiss-Prot Function]
• Protein Pathways: Metabolic pathways, Pentose phosphate pathway