NT5C (NM_014595) Human Recombinant Protein

CAT#: TP304265

Recombinant protein of human 5', 3'-nucleotidase, cytosolic (NT5C)

Product Images

Coomassie blue staining of purified NT5C protein (Cat# TP304265). The protein was produced from HEK293T cells transfected with NT5C cDNA clone (Cat# RC204265) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204265 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MARSVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGF
  FLDLEPIPGALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHLGPQFVERIILTRDKTVVLGD
  LLIDDKDTVRGQEETPSWEHILFTCCHNRHLVLPPTRRRLLSWSDNWREILDSKRGAAQRE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 23.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_055410
• Locus ID: 30833
• UniProt ID: Q8TCD5, V9HWF3
• Cytogenetics: 17q25.1
• Refseq Size: 975
• Refseq ORF: 603
• Synonyms: cdN; DNT; dNT-1; DNT1; HEL74; P5N2; PN-I; PN-II; UMPH2
• Summary: This gene encodes a nucleotidase that catalyzes the dephosphorylation of the 5' deoxyribonucleotides (dNTP) and 2'(3')-dNTP and ribonucleotides, but not 5' ribonucleotides. Of the different forms of nucleotidases characterized, this enzyme is unique in its preference for 5'-dNTP. It may be one of the enzymes involved in regulating the size of dNTP pools in cells. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Nov 2011]
• Protein Families: Transcription Factors
• Protein Pathways: Metabolic pathways, Nicotinate and nicotinamide metabolism, Purine metabolism, Pyrimidine metabolism