FLYWCH2 (NM_138439) Human Recombinant Protein
CAT#: TP304275
Recombinant protein of human FLYWCH family member 2 (FLYWCH2), transcript variant 1
View other "FLYWCH2" proteins (11)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204275 protein sequence
Red=Cloning site Green=Tags(s) MPLPEPSEQEGESVKASQEPSPKPGTEVIPAAPRKPRKFSKLVLLTASKDSTKVAGAKRKGVHCVMSLGV PGPATLAKALLQTHPEAQRAIEAAPQEPEQKRSRQDPGTDRTEDSGLAAGPPEAAGENFAPCSVAPGKSL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14.4 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_612448 |
Locus ID | 114984 |
UniProt ID | Q96CP2 |
Cytogenetics | 16p13.3 |
Refseq Size | 1044 |
Refseq ORF | 420 |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408693 | FLYWCH2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC428133 | FLYWCH2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC428134 | FLYWCH2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY408693 | Transient overexpression lysate of FLYWCH family member 2 (FLYWCH2), transcript variant 1 |
USD 396.00 |
|
LY428133 | Transient overexpression lysate of FLYWCH family member 2 (FLYWCH2), transcript variant 2 |
USD 396.00 |
|
LY428134 | Transient overexpression lysate of FLYWCH family member 2 (FLYWCH2), transcript variant 3 |
USD 396.00 |
|
PH304275 | FLYWCH2 MS Standard C13 and N15-labeled recombinant protein (NP_612448) |
USD 2,055.00 |
|
PH326732 | FLYWCH2 MS Standard C13 and N15-labeled recombinant protein (NP_001135971) |
USD 2,055.00 |
|
PH326791 | FLYWCH2 MS Standard C13 and N15-labeled recombinant protein (NP_001135972) |
USD 2,055.00 |
|
TP326732 | Recombinant protein of human FLYWCH family member 2 (FLYWCH2), transcript variant 2 |
USD 748.00 |
|
TP326791 | Recombinant protein of human FLYWCH family member 2 (FLYWCH2), transcript variant 3 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review