TCP1 epsilon (CCT5) (NM_012073) Human Recombinant Protein
CAT#: TP304358
Recombinant protein of human chaperonin containing TCP1, subunit 5 (epsilon) (CCT5)
View other "CCT5" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 415.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204358 protein sequence
Red=Cloning site Green=Tags(s) MASMGTLAFDEYGRPFLIIKDQDRKSRLMGLEALKSHIMAAKAVANTMRTSLGPNGLDKMMVDKDGDVTV TNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEEAEQLLDRGIHPIRIADGYEQA ARVAIEHLDKISDSVLVDIKDTEPLIQTAKTTLGSKVVNSCHRQMAEIAVNAVLTVADMERRDVDFELIK VEGKVGGRLEDTKLIKGVIVDKDFSHPQMPKKVEDAKIAILTCPFEPPKPKTKHKLDVTSVEDYKALQKY EKEKFEEMIQQIKETGANLAICQWGFDDEANHLLLQNNLPAVRWVGGPEIELIAIATGGRIVPRFSELTA EKLGFAGLVQEISFGTTKDKMLVIEQCKNSRAVTIFIRGGNKMIIEEAKRSLHDALCVIRNLIRDNRVVY GGGAAEISCALAVSQEADKCPTLEQYAMRAFADALEVIPMALSENSGMNPIQTMTEVRARQVKEMNPALG IDCLHKGTNDMKQQHVIETLIGKKQQISLATQMVRMILKIDDIRKPGESEE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 59.5 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_036205 |
Locus ID | 22948 |
UniProt ID | P48643, V9HW37 |
Cytogenetics | 5p15.2 |
Refseq Size | 3403 |
Refseq ORF | 1623 |
Synonyms | CCT-epsilon; CCTE; HEL-S-69; PNAS-102; TCP-1-epsilon |
Summary | The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Mutations in this gene cause hereditary sensory and autonomic neuropathy with spastic paraplegia (HSNSP). Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 5 and 13. [provided by RefSeq, Apr 2015] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415998 | CCT5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY415998 | Transient overexpression lysate of chaperonin containing TCP1, subunit 5 (epsilon) (CCT5) |
USD 396.00 |
|
PH304358 | CCT5 MS Standard C13 and N15-labeled recombinant protein (NP_036205) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review