BAX (NM_138761) Human Recombinant Protein
CAT#: TP304369
Purified recombinant protein of Homo sapiens BCL2-associated X protein (BAX), transcript variant alpha
USD 379.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204369 representing NM_138761
Red=Cloning site Green=Tags(s) MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDEL DSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWT LDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_620116 |
Locus ID | 581 |
UniProt ID | Q07812 |
Cytogenetics | 19q13.33 |
Refseq Size | 888 |
Refseq ORF | 576 |
Synonyms | BCL2L4 |
Summary | The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. The association and the ratio of BAX to BCL2 also determines survival or death of a cell following an apoptotic stimulus. This protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene. [provided by RefSeq, Dec 2019] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Amyotrophic lateral sclerosis (ALS), Apoptosis, Colorectal cancer, Huntington's disease, Neurotrophin signaling pathway, p53 signaling pathway, Pathways in cancer, Prion diseases |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408504 | BAX HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC408505 | BAX HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY408504 | Transient overexpression lysate of BCL2-associated X protein (BAX), transcript variant alpha |
USD 396.00 |
|
LY408505 | Transient overexpression lysate of BCL2-associated X protein (BAX), transcript variant delta |
USD 396.00 |
|
PH304369 | BAX MS Standard C13 and N15-labeled recombinant protein (NP_620116) |
USD 2,055.00 |
|
TP720866 | Purified recombinant protein of Human BCL2-associated X protein (BAX), transcript variant alpha |
USD 330.00 |
|
TP750152 | Purified recombinant protein of Human BCL2-associated X protein (BAX), transcript variant alpha, Met1-Gln171, with C-terminal HIS tag, expressed in E.Coli, 50 ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review