PTP alpha (PTPRA) (NM_080841) Human Recombinant Protein
CAT#: TP304392
Recombinant protein of human protein tyrosine phosphatase, receptor type, A (PTPRA), transcript variant 3
View other "PTPRA" proteins (11)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204392 protein sequence
Red=Cloning site Green=Tags(s) MDSWFILVLLGSGLICVSANNATTVAPSVGITRLINSSTAEPVKEEAKTSNPTSSLTSLSVAPTFSPNIT LGPTYLTTVNSSDSDNGTTRTASTNSIGITISPNGTWLPDNQFTDARTEPWEGNSSTAATTPETFPPSDE TPIIAVMVALSSLLVIVFIIIVLYMLRFKKYKQAGSHSNSFRLSNGRTEDVEPQSVPLLARSPSTNRKYP PLPVDKLEEEINRRMADDNKLFREEFNALPACPIQATCEAASKEENKEKNRYVNILPYDHSRVHLTPVEG VPDSDYINASFINGYQEKNKFIAAQGPKEETVNDFWRMIWEQNTATIVMVTNLKERKECKCAQYWPDQGC WTYGNIRVSVEDVTVLVDYTVRKFCIQQVGDMTNRKPQRLITQFHFTSWPDFGVPFTPIGMLKFLKKVKA CNPQYAGAIVVHCSAGVGRTGTFVVIDAMLDMMHTERKVDVYGFVSRIRAQRCQMVQTDMQYVFIYQALL EHYLYGDTELEVTSLETHLQKIYNKIPGTSNNGLEEEFKKLTSIKIQNDKMRTGNLPANMKKNRVLQIIP YEFNRVIIPVKRGEENTDYVNASFIDGYRQKDSYIASQGPLLHTIEDFWRMIWEWKSCSIVMLTELEERG QEKCAQYWPSDGLVSYGDITVELKKEEECESYTVRDLLVTNTRENKSRQIRQFHFHGWPEVGIPSDGKGM ISIIAAVQKQQQQSGNHPITVHCSAGAGRTGTFCALSTVLERVKAEGILDVFQTVKSLRLQRPHMVQTLE QYEFCYKVVQEYIDAFSDYANFK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 87.6 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_543031 |
Locus ID | 5786 |
UniProt ID | P18433 |
Cytogenetics | 20p13 |
Refseq Size | 3153 |
Refseq ORF | 2379 |
Synonyms | HEPTP; HLPR; HPTPA; HPTPalpha; LRP; PTPA; PTPRL2; R-PTP-alpha; RPTPA |
Summary | The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains an extracellular domain, a single transmembrane segment and two tandem intracytoplasmic catalytic domains, and thus represents a receptor-type PTP. This PTP has been shown to dephosphorylate and activate Src family tyrosine kinases, and is implicated in the regulation of integrin signaling, cell adhesion and proliferation. Three alternatively spliced variants of this gene, which encode two distinct isoforms, have been reported. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Phosphatase, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401026 | PTPRA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC409009 | PTPRA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC409010 | PTPRA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC429978 | PTPRA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LY401026 | Transient overexpression lysate of protein tyrosine phosphatase, receptor type, A (PTPRA), transcript variant 1 |
USD 396.00 |
|
LY409009 | Transient overexpression lysate of protein tyrosine phosphatase, receptor type, A (PTPRA), transcript variant 2 |
USD 396.00 |
|
LY409010 | Transient overexpression lysate of protein tyrosine phosphatase, receptor type, A (PTPRA), transcript variant 3 |
USD 396.00 |
|
LY429978 | Transient overexpression lysate of protein tyrosine phosphatase, receptor type, A (PTPRA), transcript variant 2 |
USD 605.00 |
|
PH304392 | PTPRA MS Standard C13 and N15-labeled recombinant protein (NP_543031) |
USD 2,055.00 |
|
PH322592 | PTPRA MS Standard C13 and N15-labeled recombinant protein (NP_002827) |
USD 2,055.00 |
|
TP322592 | Recombinant protein of human protein tyrosine phosphatase, receptor type, A (PTPRA), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review