SLP76 (LCP2) (NM_005565) Human Recombinant Protein

CAT#: TP304404

Recombinant protein of human lymphocyte cytosolic protein 2 (SH2 domain containing leukocyte protein of 76kDa) (LCP2)

Product Images

Coomassie blue staining of purified LCP2 protein (Cat# TP304404). The protein was produced from HEK293T cells transfected with LCP2 cDNA clone (Cat# RC204404) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204404 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MALRNVPFRSEVLGWDPDSLADYFKKLNYKDCEKAVKKYHIDGARFLNLTENDIQKFPKLRVPILSKLSQ
  EINKNEERRSIFTRKPQVPRFPEETESHEEDNGGWSSFEEDDYESPNDDQDGEDDGDYESPNEEEEAPVE
  DDADYEPPPSNDEEALQNSILPAKPFPNSNSMYIDRPPSGKTPQQPPVPPQRPMAALPPPPAGRNHSPLP
  PPQTNHEEPSRSRNHKTAKLPAPSIDRSTKPPLDRSLAPFDREPFTLGKKPPFSDKPSIPAGRSLGEHLP
  KIQKPPLPPTTERHERSSPLPGKKPPVPKHGWGPDRRENDEDDVHQRPLPQPALLPMSSNTFPSRSTKPS
  PMNPLPSSHMPGAFSESNSSFPQSASLPPYFSQGPSNRPPIRAEGRNFPLPLPNKPRPPSPAEEENSLNE
  EWYVSYITRPEAEAALRKINQDGTFLVRDSSKKTTTNPYVLMVLYKDKVYNIQIRYQKESQVYLLGTGLR
  GKEDFLSVSDIIDYFRKMPLLLIDGKNRGSRYQCTLTHAAGYP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 60 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005556
• Locus ID: 3937
• UniProt ID: Q13094
• Cytogenetics: 5q35.1
• Refseq Size: 2472
• Refseq ORF: 1599
• Synonyms: IMD81; SLP-76; SLP76
• Summary: This gene encodes an adapter protein that acts as a substrate of the T cell antigen receptor (TCR)-activated protein tyrosine kinase pathway. The encoded protein associates with growth factor receptor bound protein 2, and is thought to play a role TCR-mediated intracellular signal transduction. A similar protein in mouse plays a role in normal T-cell development and activation. Mice lacking this gene show subcutaneous and intraperitoneal fetal hemorrhaging, dysfunctional platelets and impaired viability. [provided by RefSeq, Nov 2016]
• Protein Pathways: Fc epsilon RI signaling pathway, Natural killer cell mediated cytotoxicity, T cell receptor signaling pathway