SMR3B (NM_006685) Human Recombinant Protein

CAT#: TP304422

Purified recombinant protein of Homo sapiens submaxillary gland androgen regulated protein 3B (SMR3B)

Product Images

Coomassie blue staining of purified SMR3B protein (Cat# TP304422). The protein was produced from HEK293T cells transfected with SMR3B cDNA clone (Cat# RC204422) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204422 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKSLTWILGLWALAACFTPGESQRGPRGPYPPGPLAPPQPFGPGFVPPPPPPPYGPGRIPPPPPAPYGPG
  IFPPPPPQP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006676
• Locus ID: 10879
• UniProt ID: P02814, Q504X8
• Cytogenetics: 4q13.3
• Refseq Size: 798
• Refseq ORF: 237
• Synonyms: P-B; PBII; PRL3; PROL3; SMR1B
• Protein Families: Secreted Protein