Caspase 3 (CASP3) (NM_032991) Human Recombinant Protein
CAT#: TP304444
Recombinant protein of human caspase 3, apoptosis-related cysteine peptidase (CASP3), transcript variant beta
View other "CASP3" proteins (7)
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC204444 protein sequence
Red=Cloning site Green=Tags(s) MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVD AANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKIT NFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDSGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSK DGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 31.4 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_116786 |
| Locus ID | 836 |
| UniProt ID | P42574 |
| Cytogenetics | 4q35.1 |
| Refseq Size | 2522 |
| Refseq ORF | 831 |
| Synonyms | CPP32; CPP32B; SCA-1 |
| Summary | The protein encoded by this gene is a cysteine-aspartic acid protease that plays a central role in the execution-phase of cell apoptosis. The encoded protein cleaves and inactivates poly(ADP-ribose) polymerase while it cleaves and activates sterol regulatory element binding proteins as well as caspases 6, 7, and 9. This protein itself is processed by caspases 8, 9, and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease. [provided by RefSeq, Aug 2017] |
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Protease |
| Protein Pathways | Alzheimer's disease, Amyotrophic lateral sclerosis (ALS), Apoptosis, Colorectal cancer, Epithelial cell signaling in Helicobacter pylori infection, Huntington's disease, MAPK signaling pathway, Natural killer cell mediated cytotoxicity, p53 signaling pathway, Parkinson's disease, Pathways in cancer, Viral myocarditis |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403215 | CASP3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC418048 | CASP3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY403215 | Transient overexpression lysate of caspase 3, apoptosis-related cysteine peptidase (CASP3), transcript variant beta |
USD 396.00 |
|
| LY418048 | Transient overexpression lysate of caspase 3, apoptosis-related cysteine peptidase (CASP3), transcript variant alpha |
USD 436.00 |
|
| PH304444 | CASP3 MS Standard C13 and N15-labeled recombinant protein (NP_116786) |
USD 2,055.00 |
|
| PH323662 | CASP3 MS Standard C13 and N15-labeled recombinant protein (NP_004337) |
USD 2,055.00 |
|
| TP323662 | Recombinant protein of human caspase 3, apoptosis-related cysteine peptidase (CASP3), transcript variant alpha |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China