GTDC1 (NM_024659) Human Recombinant Protein

CAT#: TP304594

Recombinant protein of human glycosyltransferase-like domain containing 1 (GTDC1), transcript variant 2

Product Images

Coomassie blue staining of purified GTDC1 protein (Cat# TP304594). The protein was produced from HEK293T cells transfected with GTDC1 cDNA clone (Cat# RC204594) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204594 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSILIIEAFYGGSHKQLVDLLQEELGDCVVYTLPAKKWHWRARTSALYFSQTIPISEHYRTLFASSVLNL
  TELAALRPDLGKLKKILYFHENQLIYPVKKCQERDFQYGYNQILSCLVADVVVFNSVFNMESFLTSMGKF
  MKLIPDHRPKDLESIIRPKCQVIYFPIRFPDVSRFMPKHKTTHLKKMLGLKGNGGAVLSMALPFQPEQRD
  SEDLLKNFNSECDTHCGLDTARQEYLGNSLRQESDLKKSTSSDNSSSHHGENKQNLTVDPCDILGGVDNQ
  QRLLHIVWPHRWLEAVYCGCYPLCPKDLVYPEIFPAEYLYSTPEQLSKRLQNFCKRPDIIRKHLYKGEIA
  PFSWAALHGKFRSLLTTEPREDL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 42.9 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_078935
• Locus ID: 79712
• UniProt ID: Q4AE62
• Cytogenetics: 2q22.3
• Refseq Size: 2419
• Refseq ORF: 1119
• Synonyms: Hmat-Xa; mat-Xa