RAB8B (NM_016530) Human Recombinant Protein

CAT#: TP304651

Recombinant protein of human RAB8B, member RAS oncogene family (RAB8B)

Product Images

Coomassie blue staining of purified RAB8B protein (Cat# TP304651). The protein was produced from HEK293T cells transfected with RAB8B cDNA clone (Cat# RC204651) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204651 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERF
  RTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLA
  IDYGIKFLETSAKSSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTSFFRCSLL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 23.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057614
• Locus ID: 51762
• UniProt ID: Q92930
• Cytogenetics: 15q22.2
• Refseq Size: 4877
• Refseq ORF: 621
• Summary: RAB proteins, like RAB8B, are low molecular mass monomeric GTPases that localize on the cytoplasmic surfaces of distinct membrane-bound organelles. RAB proteins function in intracellular vesicle transport by aiding in the docking and/or fusion of vesicles with their target membranes (summary by Chen et al., 1997 [PubMed 9030196]).[supplied by OMIM, Nov 2010]
• Protein Families: Druggable Genome