DARC (ACKR1) (NM_002036) Human Recombinant Protein

CAT#: TP304680

Recombinant protein of human Duffy blood group, chemokine receptor (DARC), transcript variant 2

Product Images

Coomassie blue staining of purified ACKR1 protein (Cat# TP304680). The protein was produced from HEK293T cells transfected with ACKR1 cDNA clone (Cat# RC204680) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204680 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSV
  LGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSA
  FAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATH
  TVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQ
  ALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWFSHLDTLGSKS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 35.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002027
• Locus ID: 2532
• UniProt ID: Q16570, Q5Y7A2
• Cytogenetics: 1q23.2
• Refseq Size: 2024
• Refseq ORF: 1008
• Synonyms: CCBP1; CD234; DARC; DARC/ACKR1; Dfy; FY; GPD; GpFy; WBCQ1
• Summary: The protein encoded by this gene is a glycosylated membrane protein and a non-specific receptor for several chemokines. The encoded protein is the receptor for the human malarial parasites Plasmodium vivax and Plasmodium knowlesi. Polymorphisms in this gene are the basis of the Duffy blood group system. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, GPCR, Transmembrane