CFHL2 (CFHR2) (NM_005666) Human Recombinant Protein
CAT#: TP304689
Purified recombinant protein of Homo sapiens complement factor H-related 2 (CFHR2)
View other "CFHR2" proteins (4)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204689 protein sequence
Red=Cloning site Green=Tags(s) MWLLVSVILISRISSVGGEAMFCDFPKINHGILYDEEKYKPFSQVPTGEVFYYSCEYNFVSPSKSFWTRI TCAEEGWSPTPKCLRLCFFPFVENGHSESSGQTHLEGDTVQIICNTGYRLQNNENNISCVERGWSTPPKC RSTISAEKCGPPPPIDNGDITSFLLSVYAPGSSVEYQCQNLYQLEGNNQITCRNGQWSEPPKCLDPCVIS QEIMEKYNIKLKWTNQQKLYSRTGDIVEFVCKSGYHPTKSHSFRAMCQNGKLVYPSCEEK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 30.5 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005657 |
Locus ID | 3080 |
UniProt ID | P36980 |
Cytogenetics | 1q31.3 |
Refseq Size | 1043 |
Refseq ORF | 810 |
Synonyms | CFHL2; FHR2; HFL3 |
Summary | This gene belongs to a family of complement factor H-related genes (CFHR), which are clustered together with complement factor H gene on chromosome 1, and are involved in regulation of complement. Mutations in CFHR genes have been associated with dense deposit disease and atypical haemolytic-uraemic syndrome. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Aug 2015] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401729 | CFHR2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401729 | Transient overexpression lysate of complement factor H-related 2 (CFHR2) |
USD 396.00 |
|
PH304689 | CFHR2 MS Standard C13 and N15-labeled recombinant protein (NP_005657) |
USD 2,055.00 |
|
TP720675 | Purified recombinant protein of Human complement factor H-related 2 (CFHR2) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review