CFHL2 (CFHR2) (NM_005666) Human Recombinant Protein

CAT#: TP304689

Purified recombinant protein of Homo sapiens complement factor H-related 2 (CFHR2)

Product Images

Coomassie blue staining of purified CFHR2 protein (Cat# TP304689). The protein was produced from HEK293T cells transfected with CFHR2 cDNA clone (Cat# RC204689) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204689 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MWLLVSVILISRISSVGGEAMFCDFPKINHGILYDEEKYKPFSQVPTGEVFYYSCEYNFVSPSKSFWTRI
  TCAEEGWSPTPKCLRLCFFPFVENGHSESSGQTHLEGDTVQIICNTGYRLQNNENNISCVERGWSTPPKC
  RSTISAEKCGPPPPIDNGDITSFLLSVYAPGSSVEYQCQNLYQLEGNNQITCRNGQWSEPPKCLDPCVIS
  QEIMEKYNIKLKWTNQQKLYSRTGDIVEFVCKSGYHPTKSHSFRAMCQNGKLVYPSCEEK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 30.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005657
• Locus ID: 3080
• UniProt ID: P36980
• Cytogenetics: 1q31.3
• Refseq Size: 1043
• Refseq ORF: 810
• Synonyms: CFHL2; FHR2; HFL3
• Summary: This gene belongs to a family of complement factor H-related genes (CFHR), which are clustered together with complement factor H gene on chromosome 1, and are involved in regulation of complement. Mutations in CFHR genes have been associated with dense deposit disease and atypical haemolytic-uraemic syndrome. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Aug 2015]
• Protein Families: Secreted Protein