beta Sarcoglycan (SGCB) (NM_000232) Human Recombinant Protein

CAT#: TP304699

Recombinant protein of human sarcoglycan, beta (43kDa dystrophin-associated glycoprotein) (SGCB)

Product Images

Coomassie blue staining of purified SGCB protein (Cat# TP304699). The protein was produced from HEK293T cells transfected with SGCB cDNA clone (Cat# RC204699) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204699 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAAAAAAAEQQSSNGPVKKSMREKAVERRSVNKEHNSNFKAGYIPIDEDRLHKTGLRGRKGNLAICVII
  LLFILAVINLIITLVIWAVIRIGPNGCDSMEFHESGLLRFKQVSDMGVIHPLYKSTVGGRRNENLVITGN
  NQPIVFQQGTTKLSVENNKTSITSDIGMQFFDPRTQNILFSTDYETHEFHLPSGVKSLNVQKASTERITS
  NATSDLNIKVDGRAIVRGNEGVFIMGKTIEFHMGGNMELKAENSIILNGSVMVSTTRLPSSSSGDQLGSG
  DWVRYKLCMCADGTLFKVQVTSQNMGCQISDNPCGNTH
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 34.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_000223
• Locus ID: 6443
• UniProt ID: Q16585, Q5U0N0
• Cytogenetics: 4q12
• Refseq Size: 4295
• Refseq ORF: 954
• Synonyms: A3b; LGMD2E; LGMDR4; SGC
• Summary: This gene encodes a member of the sarcoglycan family. Sarcoglycans are transmembrane components in the dystrophin-glycoprotein complex which help stabilize the muscle fiber membranes and link the muscle cytoskeleton to the extracellular matrix. Mutations in this gene have been associated with limb-girdle muscular dystrophy.[provided by RefSeq, Oct 2008]
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Arrhythmogenic right ventricular cardiomyopathy (ARVC), Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM), Viral myocarditis