CLIC2 (NM_001289) Human Recombinant Protein

CAT#: TP304727

Recombinant protein of human chloride intracellular channel 2 (CLIC2)

Product Images

Autoantibodies against chloride intracellular channel 2 (CLIC2) and high mobility group box 1 (HMGB1) in sera from systemic lupus erythematosus patients (n = 43) versus healthy controls (n = 43) were detected in ELISA assays with CLIC2 (OriGene TP304727) and HMGB1 (OriGene TP720309) recombinant proteins. Figure cited from J Postgrad Med, PMID: 28862243

• 

  Coomassie blue staining of purified CLIC2 protein (Cat# TP304727). The protein was produced from HEK293T cells transfected with CLIC2 cDNA clone (Cat# RC204727) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204727 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSGLRPGTQVDPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGTNP
  PFLVYNKELKTDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLL
  KEFKRLDDYLNTPLLDEIDPDSAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFS
  GVWRYLHNAYAREEFTHTCPEDKEIENTYANVAKQKS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 28.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Bioactivity: ELISA capture for autoantibodies (PMID: 28862243)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001280
• Locus ID: 1193
• UniProt ID: O15247
• Cytogenetics: Xq28
• Refseq Size: 2694
• Refseq ORF: 741
• Synonyms: CLCNL2; CLIC2b; MRXS32; XAP121
• Summary: This gene encodes a chloride intracellular channel protein. Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. This protein plays a role in inhibiting the function of ryanodine receptor 2. A mutation in this gene is the cause of an X-linked form of cognitive disability. [provided by RefSeq, Jul 2017]
• Protein Families: Druggable Genome, Ion Channels: Other