CLIC2 (NM_001289) Human Recombinant Protein
CAT#: TP304727
Recombinant protein of human chloride intracellular channel 2 (CLIC2)
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC204727 protein sequence
Red=Cloning site Green=Tags(s) MSGLRPGTQVDPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGTNP PFLVYNKELKTDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLL KEFKRLDDYLNTPLLDEIDPDSAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFS GVWRYLHNAYAREEFTHTCPEDKEIENTYANVAKQKS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 28.2 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Bioactivity | ELISA capture for autoantibodies (PMID: 28862243) |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001280 |
| Locus ID | 1193 |
| UniProt ID | O15247 |
| Cytogenetics | Xq28 |
| Refseq Size | 2694 |
| Refseq ORF | 741 |
| Synonyms | CLCNL2; CLIC2b; MRXS32; XAP121 |
| Summary | This gene encodes a chloride intracellular channel protein. Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. This protein plays a role in inhibiting the function of ryanodine receptor 2. A mutation in this gene is the cause of an X-linked form of cognitive disability. [provided by RefSeq, Jul 2017] |
| Protein Families | Druggable Genome, Ion Channels: Other |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC420025 | CLIC2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY420025 | Transient overexpression lysate of chloride intracellular channel 2 (CLIC2) |
USD 436.00 |
|
| PH304727 | CLIC2 MS Standard C13 and N15-labeled recombinant protein (NP_001280) |
USD 2,055.00 |
|
| TP720238 | Recombinant protein of human chloride intracellular channel 2 (CLIC2) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China