SERF2 (NM_001018108) Human Recombinant Protein
CAT#: TP304784
Recombinant protein of human small EDRK-rich factor 2 (SERF2)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204784 protein sequence
Red=Cloning site Green=Tags(s) MTRGNQRELARQKNMKKQSDSVKGKRRDDGLSAAARKQRDSEIMQQKQKKANEKKEEPK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 6.7 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001018118 |
Locus ID | 10169 |
UniProt ID | P84101 |
Cytogenetics | 15q15.3 |
Refseq Size | 3048 |
Refseq ORF | 177 |
Synonyms | 4F5REL; FAM2C; H4F5REL; HsT17089 |
Summary | Positive regulator of amyloid protein aggregation and proteotoxicity (PubMed:20723760). Induces conformational changes in amyloid proteins, such as HTT, driving them into compact formations preceding the formation of aggregates (PubMed:20723760).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422655 | SERF2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY422655 | Transient overexpression lysate of small EDRK-rich factor 2 (SERF2) |
USD 396.00 |
|
PH304784 | SERF2 MS Standard C13 and N15-labeled recombinant protein (NP_001018118) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review