SERF2 (NM_001018108) Human Recombinant Protein

CAT#: TP304784

Recombinant protein of human small EDRK-rich factor 2 (SERF2)

Product Images

Coomassie blue staining of purified SERF2 protein (Cat# TP304784). The protein was produced from HEK293T cells transfected with SERF2 cDNA clone (Cat# RC204784) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204784 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTRGNQRELARQKNMKKQSDSVKGKRRDDGLSAAARKQRDSEIMQQKQKKANEKKEEPK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 6.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001018118
• Locus ID: 10169
• UniProt ID: P84101
• Cytogenetics: 15q15.3
• Refseq Size: 3048
• Refseq ORF: 177
• Synonyms: 4F5REL; FAM2C; H4F5REL; HsT17089
• Summary: Positive regulator of amyloid protein aggregation and proteotoxicity (PubMed:20723760). Induces conformational changes in amyloid proteins, such as HTT, driving them into compact formations preceding the formation of aggregates (PubMed:20723760).[UniProtKB/Swiss-Prot Function]