HSPC014 (POMP) (NM_015932) Human Recombinant Protein

CAT#: TP304812

Recombinant protein of human proteasome maturation protein (POMP)

Product Images

Coomassie blue staining of purified POMP protein (Cat# TP304812). The protein was produced from HEK293T cells transfected with POMP cDNA clone (Cat# RC204812) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204812 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNARGLGSELKDSIPVTELSASGPFESHDLLRKGFSCVKNELLPSHPLELSEKNFQLNQDKMNFSTLRNI
  QGLFAPLKLQMEFKAVQQVQRLPFLSSSNLSLDVLRGNDETIGFEDILNDPSQSEVMGEPHLMVEYKLGL
  L
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 15.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057016
• Locus ID: 51371
• UniProt ID: Q9Y244
• Cytogenetics: 13q12.3
• Refseq Size: 1477
• Refseq ORF: 423
• Synonyms: C13orf12; HSPC014; PNAS-110; PRAAS2; UMP1
• Summary: The protein encoded by this gene is a molecular chaperone that binds 20S preproteasome components and is essential for 20S proteasome formation. The 20S proteasome is the proteolytically active component of the 26S proteasome complex. The encoded protein is degraded before the maturation of the 20S proteasome is complete. A variant in the 5' UTR of this gene has been associated with KLICK syndrome, a rare skin disorder.[provided by RefSeq, Aug 2010]
• Protein Pathways: Proteasome