SMPDL3B (NM_001009568) Human Recombinant Protein

CAT#: TP304846

Recombinant protein of human sphingomyelin phosphodiesterase, acid-like 3B (SMPDL3B), transcript variant 2

Product Images

Coomassie blue staining of purified SMPDL3B protein (Cat# TP304846). The protein was produced from HEK293T cells transfected with SMPDL3B cDNA clone (Cat# RC204846) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204846 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRLLAWLIFLANWGGARAEPGKFWHIADLHLDPDYKVSKDPFQVCPSAGSQPVPDAGPWGDYLCDSPWAL
  INSSIYAMKEIEPEPDFILWTGDDTPHVPDEKLGEAAVLEIVERLTKLIREVFPDTKVYAALGNHDFHPK
  NQFPAGSNNIYNQIAELWKPWLSNESIALFKKGAFYCEKLPGPSGAGRIVVLNTNLYYTSNALTADMADP
  GQQFQWLEDVLTDASKAGDMVYIVGHVPPGFFEKTQNKAWFREGFNEKYLKVVRKHHRVIAGQFFGHHHT
  DSFRMLYDDAGVPISAMFITPGVTPWKTTLPGVVNGANNPAIRVFEYDRATLSLKVRSPAEARGGGWEGL
  KCITTFPHSQLIHLPLTTEPQEG
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 41.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001009568
• Locus ID: 27293
• UniProt ID: Q92485
• Cytogenetics: 1p35.3
• Refseq Size: 1611
• Refseq ORF: 1119
• Synonyms: ASML3B
• Summary: Lipid-modulating phosphodiesterase (PubMed:26095358). Active on the surface of macrophages and dendritic cells and strongly influences macrophage lipid composition and membrane fluidity. Acts as a negative regulator of Toll-like receptor signaling (By similarity). Has in vitro phosphodiesterase activity, but the physiological substrate is unknown (PubMed:26095358). Lacks activity with phosphocholine-containing lipids, but can cleave CDP-choline, and can release phosphate from ATP and ADP (in vitro) (By similarity).[UniProtKB/Swiss-Prot Function]
• Protein Families: Secreted Protein