GRO beta (CXCL2) (NM_002089) Human Recombinant Protein

CAT#: TP304877

Recombinant protein of human chemokine (C-X-C motif) ligand 2 (CXCL2)

Product Images

Coomassie blue staining of purified CXCL2 protein (Cat# TP304877). The protein was produced from HEK293T cells transfected with CXCL2 cDNA clone (Cat# RC204877) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204877 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MARATLSAAPSNPRLLRVALLLLLLVAASRRAAGAPLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCA
  QTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 11.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002080
• Locus ID: 2920
• UniProt ID: P19875, A0A024RDD9
• Cytogenetics: 4q13.3
• Refseq Size: 1234
• Refseq ORF: 321
• Synonyms: CINC-2a; GRO2; GROb; MGSA-b; MIP-2a; MIP2; MIP2A; SCYB2
• Summary: This antimicrobial gene is part of a chemokine superfamily that encodes secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CXC subfamily, is expressed at sites of inflammation and may suppress hematopoietic progenitor cell proliferation. [provided by RefSeq, Sep 2014]
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Chemokine signaling pathway, Cytokine-cytokine receptor interaction, NOD-like receptor signaling pathway