GRO beta (CXCL2) (NM_002089) Human Mass Spec Standard

CAT#: PH304877

CXCL2 MS Standard C13 and N15-labeled recombinant protein (NP_002080)

Product Images

Coomassie blue staining of purified CXCL2 protein (Cat# TP304877). The protein was produced from HEK293T cells transfected with CXCL2 cDNA clone (Cat# RC204877) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204877
• Predicted MW: 11.4 kDa
• Protein Sequence:
  Sequence Link

  >RC204877 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MARATLSAAPSNPRLLRVALLLLLLVAASRRAAGAPLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCA
  QTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002080
• RefSeq Size: 1234
• RefSeq ORF: 321
• Synonyms: CINC-2a; GRO2; GROb; MGSA-b; MIP-2a; MIP2; MIP2A; SCYB2
• Locus ID: 2920
• UniProt ID: P19875, A0A024RDD9
• Cytogenetics: 4q13.3
• Summary: 'This antimicrobial gene is part of a chemokine superfamily that encodes secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CXC subfamily, is expressed at sites of inflammation and may suppress hematopoietic progenitor cell proliferation. [provided by RefSeq, Sep 2014]'
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Chemokine signaling pathway, Cytokine-cytokine receptor interaction, NOD-like receptor signaling pathway