GRO beta (CXCL2) (NM_002089) Human Mass Spec Standard
CAT#: PH304877
CXCL2 MS Standard C13 and N15-labeled recombinant protein (NP_002080)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204877 |
Predicted MW | 11.4 kDa |
Protein Sequence |
>RC204877 protein sequence
Red=Cloning site Green=Tags(s) MARATLSAAPSNPRLLRVALLLLLLVAASRRAAGAPLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCA QTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002080 |
RefSeq Size | 1234 |
RefSeq ORF | 321 |
Synonyms | CINC-2a; GRO2; GROb; MGSA-b; MIP-2a; MIP2; MIP2A; SCYB2 |
Locus ID | 2920 |
UniProt ID | P19875, A0A024RDD9 |
Cytogenetics | 4q13.3 |
Summary | 'This antimicrobial gene is part of a chemokine superfamily that encodes secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CXC subfamily, is expressed at sites of inflammation and may suppress hematopoietic progenitor cell proliferation. [provided by RefSeq, Sep 2014]' |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction, NOD-like receptor signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
TP304877 | Recombinant protein of human chemokine (C-X-C motif) ligand 2 (CXCL2) |
USD 823.00 |
|
TP720606 | Purified recombinant protein of Human chemokine (C-X-C motif) ligand 2 (CXCL2) |
USD 330.00 |
|
TP723149 | Purified recombinant protein of Human chemokine (C-X-C motif) ligand 2 (CXCL2). |
USD 240.00 |
|
TP723792 | Purified recombinant protein of Human chemokine (C-X-C motif) ligand 2 (CXCL2 / Grobeta) |
USD 255.00 |
{0} Product Review(s)
Be the first one to submit a review