CCDC12 (NM_144716) Human Recombinant Protein

CAT#: TP305023

Recombinant protein of human coiled-coil domain containing 12 (CCDC12)

Product Images

Coomassie blue staining of purified CCDC12 protein (Cat# TP305023). The protein was produced from HEK293T cells transfected with CCDC12 cDNA clone (Cat# RC205023) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205023 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEATTAGVGRLEEEALRRKERLKALREKTGRKDKEDGEPKTKHLREEEEEGEKHRELRLRNYVPEDEDLK
  KRRVPQAKPVAVEEKVKEQLEAAKPEPVIEEVDLANLAPRKPDWDLKRDVAKKLEKLKKRTQRAIAELIR
  ERLKGQEDSLASAVDAATEQKTCDSD
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 20.3 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_653317
• Locus ID: 151903
• UniProt ID: J3KR35
• Cytogenetics: 3p21.31
• Refseq Size: 1035
• Refseq ORF: 498
• Protein Pathways: Spliceosome