Viperin (RSAD2) (NM_080657) Human Recombinant Protein

CAT#: TP305066

Recombinant protein of human radical S-adenosyl methionine domain containing 2 (RSAD2)

Product Images

Coomassie blue staining of purified RSAD2 protein (Cat# TP305066). The protein was produced from HEK293T cells transfected with RSAD2 cDNA clone (Cat# RC205066) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205066 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MWVLTPAAFAGKLLSVFRQPLSSLWRSLVPLFCWLRATFWLRATKRRKQQLVLRGPDETKEEEEDPPLPT
  TPTSVNYHFTRQCNYKCGFCFHTAKTSFVLPLEEAKRGLLLLKEAGMEKINFSGGEPFLQDRGEYLGKLV
  RFCKVELRLPSVSIVSNGSLIRERWFQNYGEYLDILAISCDSFDEEVNVLIGRGQGKKNHVENLQKLRRW
  CRDYRVAFKINSVINRFNVEEDMTEQIKALNPVRWKVFQCLLIEGENCGEDALREAERFVIGDEEFERFL
  ERHKEVSCLVPESNQKMKDSYLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKY
  IWSKADLKLDW
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 42 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_542388
• Locus ID: 91543
• UniProt ID: Q8WXG1
• Cytogenetics: 2p25.2
• Refseq Size: 3512
• Refseq ORF: 1083
• Synonyms: cig5; cig33; vig1
• Summary: The protein encoded by this gene is an interferon-inducible antiviral protein that belongs to the S-adenosyl-L-methionine (SAM) superfamily of enzymes. The protein plays a role in cellular antiviral response and innate immune signaling. Antiviral effects result from inhibition of viral RNA replication, interference in the secretory pathway, binding to viral proteins and dysregulation of cellular lipid metabolism. The protein has been found to inhibit both DNA and RNA viruses, including influenza virus, human immunodeficiency virus (HIV-1) and Zika virus. [provided by RefSeq, Sep 2020]