SH2D1B (NM_053282) Human Recombinant Protein

CAT#: TP305069

Recombinant protein of human SH2 domain containing 1B (SH2D1B)

Product Images

Coomassie blue staining of purified SH2D1B protein (Cat# TP305069). The protein was produced from HEK293T cells transfected with SH2D1B cDNA clone (Cat# RC205069) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205069 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDLPYYHGRLTKQDCETLLLKEGVDGNFLLRDSESIPGVLCLCVSFKNIVYTYRIFREKHGYYRIQTAEG
  SPKQVFPSLKELISKFEKPNQGMVVHLLKPIKRTSPSLRWRGLKLELETFVNSNSDYVDVLP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 15.1 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_444512
• Locus ID: 117157
• UniProt ID: O14796
• Cytogenetics: 1q23.3
• Refseq Size: 2553
• Refseq ORF: 396
• Synonyms: EAT2
• Summary: By binding phosphotyrosines through its free SRC (MIM 190090) homology-2 (SH2) domain, EAT2 regulates signal transduction through receptors expressed on the surface of antigen-presenting cells (Morra et al., 2001 [PubMed 11689425]).[supplied by OMIM, Mar 2008]
• Protein Pathways: Natural killer cell mediated cytotoxicity