SH2D1B (NM_053282) Human Mass Spec Standard

CAT#: PH305069

SH2D1B MS Standard C13 and N15-labeled recombinant protein (NP_444512)

Product Images

Coomassie blue staining of purified SH2D1B protein (Cat# TP305069). The protein was produced from HEK293T cells transfected with SH2D1B cDNA clone (Cat# RC205069) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205069
• Predicted MW: 15.3 kDa
• Protein Sequence:
  Sequence Link

  >RC205069 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDLPYYHGRLTKQDCETLLLKEGVDGNFLLRDSESIPGVLCLCVSFKNIVYTYRIFREKHGYYRIQTAEG
  SPKQVFPSLKELISKFEKPNQGMVVHLLKPIKRTSPSLRWRGLKLELETFVNSNSDYVDVLP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_444512
• RefSeq Size: 2553
• RefSeq ORF: 396
• Synonyms: EAT2
• Locus ID: 117157
• UniProt ID: O14796
• Cytogenetics: 1q23.3
• Summary: By binding phosphotyrosines through its free SRC (MIM 190090) homology-2 (SH2) domain, EAT2 regulates signal transduction through receptors expressed on the surface of antigen-presenting cells (Morra et al., 2001 [PubMed 11689425]). [supplied by OMIM, Mar 2008]
• Protein Pathways: Natural killer cell mediated cytotoxicity