TrkB (NTRK2) (NM_001007097) Human Recombinant Protein
CAT#: TP305129
Recombinant protein of human neurotrophic tyrosine kinase, receptor, type 2 (NTRK2), transcript variant b
View other "NTRK2" proteins (20)
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC205129 protein sequence
Red=Cloning site Green=Tags(s) MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITE IFIANQKRLEIINEDDVEAYVGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDL SELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNESSKNIPLANLQIPNCGLPSANLAAPNLTVEE GKSITLSCSVAGDPVPNMYWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVN LTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDN PTHMNNGDYTLIAKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDTTNRSNEIPST DVTDKTGREHLSVYAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGFVLFHKIPLDG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 49.3 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001007098 |
| Locus ID | 4915 |
| UniProt ID | Q16620, Q5VWE5 |
| Cytogenetics | 9q21.33 |
| Refseq Size | 7157 |
| Refseq ORF | 1431 |
| Synonyms | DEE58; EIEE58; GP145-TrkB; OBHD; trk-B; TRKB |
| Summary | This gene encodes a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to cell differentiation. Mutations in this gene have been associated with obesity and mood disorders. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014] |
| Protein Families | Druggable Genome, Protein Kinase, Transmembrane |
| Protein Pathways | MAPK signaling pathway, Neurotrophin signaling pathway |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400391 | NTRK2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC416818 | NTRK2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC422715 | NTRK2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC422716 | NTRK2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC422717 | NTRK2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC425423 | NTRK2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC425425 | NTRK2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY400391 | Transient overexpression lysate of neurotrophic tyrosine kinase, receptor, type 2 (NTRK2), transcript variant b |
USD 436.00 |
|
| LY416818 | Transient overexpression lysate of neurotrophic tyrosine kinase, receptor, type 2 (NTRK2), transcript variant a |
USD 665.00 |
|
| LY422715 | Transient overexpression lysate of neurotrophic tyrosine kinase, receptor, type 2 (NTRK2), transcript variant c |
USD 665.00 |
|
| LY422716 | Transient overexpression lysate of neurotrophic tyrosine kinase, receptor, type 2 (NTRK2), transcript variant d |
USD 665.00 |
|
| LY422717 | Transient overexpression lysate of neurotrophic tyrosine kinase, receptor, type 2 (NTRK2), transcript variant e |
USD 665.00 |
|
| LY425423 | Transient overexpression lysate of neurotrophic tyrosine kinase, receptor, type 2 (NTRK2), transcript variant c |
USD 605.00 |
|
| LY425425 | Transient overexpression lysate of neurotrophic tyrosine kinase, receptor, type 2 (NTRK2), transcript variant e |
USD 396.00 |
|
| PH305129 | NTRK2 MS Standard C13 and N15-labeled recombinant protein (NP_001007098) |
USD 2,055.00 |
|
| PH321794 | NTRK2 MS Standard C13 and N15-labeled recombinant protein (NP_006171) |
USD 2,055.00 |
|
| TP321794 | Recombinant protein of human neurotrophic tyrosine kinase, receptor, type 2 (NTRK2), transcript variant a |
USD 748.00 |
|
| TP700135 | Purified recombinant protein of human neurotrophic tyrosine kinase, receptor, type 2(NTRK2), transcript variant c, with C-terminal DDK/His tag, expressed in human cells, 20 µg |
USD 748.00 |
|
| TP710139 | Recombinant protein of human neurotrophic tyrosine kinase, receptor, type 2 (NTRK2), transcript variant a, residues 32-430aa, with C-terminal DDK tag, expressed in sf9, 20ug |
USD 425.00 |
|
| TP720421 | Recombinant protein of human neurotrophic tyrosine kinase, receptor, type 2 (NTRK2), transcript variant b |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China