Cbl c (CBLC) (NM_012116) Human Recombinant Protein
CAT#: TP305130
Recombinant protein of human Cas-Br-M (murine) ecotropic retroviral transforming sequence c (CBLC), transcript variant 1
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205130 protein sequence
Red=Cloning site Green=Tags(s) MALAVAPWGRQWEEARALGRAVRMLQRLEEQCVDPRLSVSPPSLRDLLPRTAQLLREVAHSRRAAGGGGP GGPGGSGDFLLIYLANLEAKSRQVAALLPPRGRRSANDELFRAGSRLRRQLAKLAIIFSHMHAELHALFP GGKYCGHMYQLTKAPAHTFWRESCGARCVLPWAEFESLLGTCHPVEPGCTALALRTTIDLTCSGHVSIFE FDVFTRLFQPWPTLLKNWQLLAVNHPGYMAFLTYDEVQERLQACRDKPGSYIFRPSCTRLGQWAIGYVSS DGSILQTIPANKPLSQVLLEGQKDGFYLYPDGKTHNPDLTELGQAEPQQRIHVSEEQLQLYWAMDSTFEL CKICAESNKDVKIEPCGHLLCSCCLAAWQHSDSQTCPFCRCEIKGWEAVSIYQFHGQATAEDPGNSSDQE GRELELGQVPLSAPPLPPRPDLPPRKPRNAQPKVRLLKGNSPPAALGPQDPAPA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 52.3 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_036248 |
Locus ID | 23624 |
UniProt ID | Q9ULV8 |
Cytogenetics | 19q13.32 |
Refseq Size | 1591 |
Refseq ORF | 1422 |
Synonyms | CBL-3; CBL-SL; RNF57 |
Summary | This gene encodes a member of the Cbl family of E3 ubiquitin ligases. Cbl proteins play important roles in cell signaling through the ubiquitination and subsequent downregulation of tyrosine kinases. Expression of this gene may be restricted to epithelial cells, and alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Feb 2012] |
Protein Families | Druggable Genome |
Protein Pathways | Chronic myeloid leukemia, Endocytosis, ErbB signaling pathway, Insulin signaling pathway, Jak-STAT signaling pathway, Pathways in cancer, T cell receptor signaling pathway, Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402148 | CBLC HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC427289 | CBLC HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402148 | Transient overexpression lysate of Cas-Br-M (murine) ecotropic retroviral transforming sequence c (CBLC), transcript variant 1 |
USD 396.00 |
|
LY427289 | Transient overexpression lysate of Cas-Br-M (murine) ecotropic retroviral transforming sequence c (CBLC), transcript variant 2 |
USD 396.00 |
|
PH305130 | CBLC MS Standard C13 and N15-labeled recombinant protein (NP_036248) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review