OLIG1 (NM_138983) Human Recombinant Protein

CAT#: TP305155

Recombinant protein of human oligodendrocyte transcription factor 1 (OLIG1)

Product Images

Coomassie blue staining of purified OLIG1 protein (Cat# TP305155). The protein was produced from HEK293T cells transfected with OLIG1 cDNA clone (Cat# RC205155) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205155 representing NM_138983
  Red=Cloning site Green=Tags(s)
  
  MYYAVSQARVNAVPGTMLRPQRPGDLQLGASLYELVGYRQPPSSSSSSTSSTSSTSSSSTTAPLLPKAAR
  EKPEAPAEPPGPGPGSGAHPGGSARPDAKEEQQQQLRRKINSRERKRMQDLNLAMDALREVILPYSAAHC
  QGAPGRKLSKIATLLLARNYILLLGSSLQELRRALGEGAGPAAPRLLLAGLPLLAAAPGSVLLAPGAVGP
  PDALRPAKYLSLALDEPPCGQFALPGGGAGGPGLCTCAVCKFPHLVPASLGLAAVQAQFSK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 27.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_620450
• Locus ID: 116448
• UniProt ID: Q8TAK6
• Cytogenetics: 21q22.11
• Refseq Size: 2293
• Refseq ORF: 813
• Synonyms: BHLHB6; BHLHE21
• Summary: Promotes formation and maturation of oligodendrocytes, especially within the brain. Cooperates with OLIG2 to establish the pMN domain of the embryonic neural tube (By similarity).[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome