VPS26 (VPS26A) (NM_004896) Human Recombinant Protein

CAT#: TP305353

Recombinant protein of human vacuolar protein sorting 26 homolog A (S. pombe) (VPS26A), transcript variant 1

Product Images

Coomassie blue staining of purified VPS26A protein (Cat# TP305353). The protein was produced from HEK293T cells transfected with VPS26A cDNA clone (Cat# RC205353) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205353 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSFLGGFFGPICEIDIVLNDGETRKMAEMKTEDGKVEKHYLFYDGESVSGKVNLAFKQPGKRLEHQGIRI
  EFVGQIELFNDKSNTHEFVNLVKELALPGELTQSRSYDFEFMQVEKPYESYIGANVRLRYFLKVTIVRRL
  TDLVKEYDLIVHQLATYPDVNNSIKMEVGIEDCLHIEFEYNKSKYHLKDVIVGKIYFLLVRIKIQHMELQ
  LIKKEITGIGPSTTTETETIAKYEIMDGAPVKGESIPIRLFLAGYDPTPTMRDVNKKFSVRYFLNLVLVD
  EEDRRYFKQQEIILWRKAPEKLRKQRTNFHQRFESPESQASAEQPEM
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 38 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_004887
• Locus ID: 9559
• UniProt ID: O75436
• Cytogenetics: 10q22.1
• Refseq Size: 2707
• Refseq ORF: 981
• Synonyms: HB58; Hbeta58; PEP8A; VPS26
• Summary: This gene belongs to a group of vacuolar protein sorting (VPS) genes. The encoded protein is a component of a large multimeric complex, termed the retromer complex, involved in retrograde transport of proteins from endosomes to the trans-Golgi network. The close structural similarity between the yeast and human proteins that make up this complex suggests a similarity in function. Expression studies in yeast and mammalian cells indicate that this protein interacts directly with VPS35, which serves as the core of the retromer complex. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]