PDHA2 (NM_005390) Human Recombinant Protein

CAT#: TP305416

Recombinant protein of human pyruvate dehydrogenase (lipoamide) alpha 2 (PDHA2)

Product Images

Coomassie blue staining of purified PDHA2 protein (Cat# TP305416). The protein was produced from HEK293T cells transfected with PDHA2 cDNA clone (Cat# RC205416) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205416 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLAAFISRVLRRVAQKSARRVLVASRNSSNDATFEIKKCDLYLLEEGPPVTTVLTRAEGLKYYRMMLTVR
  RMELKADQLYKQKFIRGFCHLCDGQEACCVGLEAGINPSDHVITSYRAHGVCYTRGLSVRSILAELTGRR
  GGCAKGKGGSMHMYTKNFYGGNGIVGAQGPLGAGIALACKYKGNDEICLTLYGDGAANQGQIAEAFNMAA
  LWKLPCVFICENNLYGMGTSTERAAASPDYYKRGNFIPGLKVDGMDVLCVREATKFAANYCRSGKGPILM
  ELQTYRYHGHSMSDPGVSYRTREEIQEVRSKRDPIIILQDRMVNSKLATVEELKEIGAEVRKEIDDAAQF
  ATTDPEPHLEELGHHIYSSDSSFEVRGANPWIKFKSVS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 42.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005381
• Locus ID: 5161
• UniProt ID: P29803
• Cytogenetics: 4q22.3
• Refseq Size: 1387
• Refseq ORF: 1164
• Synonyms: PDHAL
• Summary: The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2), and thereby links the glycolytic pathway to the tricarboxylic cycle.[UniProtKB/Swiss-Prot Function]
• Protein Pathways: Butanoate metabolism, Citrate cycle (TCA cycle), Glycolysis / Gluconeogenesis, Metabolic pathways, Pyruvate metabolism, Valine, leucine and isoleucine biosynthesis