LRRC50 (DNAAF1) (NM_178452) Human Recombinant Protein

CAT#: TP305452

Recombinant protein of human leucine rich repeat containing 50 (LRRC50)


  View other "DNAAF1" proteins (3)

USD 823.00

In Stock*

Size
    • 20 ug

Product Images

Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


LRRC50 mouse monoclonal antibody, clone OTI2C4 (formerly 2C4)
    • 100 ul

USD 379.00

Other products for "DNAAF1"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC205452 protein sequence
Red=Cloning site Green=Tags(s)

MHPEPSEPATGGAAELDCAQEPGVEESAGDHGSAGRGGCKEEINDPKEICVGSSDTSYHSQQKQSGDNGS
GGHFAHPREDREDRGPRMTKSSLQKLCKQHKLYITPALNDTLYLHFKGFDRIENLEEYTGLRCLWLQSNG
IQKIENLEAQTELRCLFLQMNLLRKIENLEPLQKLDALNLSNNYIKTIENLSCLPVLNTLQMAHNHLETV
EDIQHLQECLRLCVLDLSHNKLSDPEILSILESMPDLRVLNLMGNPVIRQIPNYRRTVTVRLKHLTYLDD
RPVFPKDRACAEAWARGGYAAEKEERQQWESRERKKITDSIEALAMIKQRAEERKRQRESQERGEMTSSD
DGENVPASAEGKEEPPGDRETRQKMELFVKESFEAKDELCPERPSGEEPPVEAKREDGGPEPEGTLPAET
LLLSSPVEVKGEDGDGEPEGTLPAEAPPPPPPVEVKGEDGDQEPEGTLPAETLLLSPPVKVKGEDGDREP
EGTLPAEAPPPLPLGAAREEPTPQAVATEGVFVTELDGTRTEDLETIRLETKETCCIDDLPDLEDDDETG
KSLEDQNMCFPKIEVISSLSDDSDPELDYTSLPVLENLPTDTLSNIFAVSKDTSKAARVPFTDIFKKEAK
RDSEIRKQDTKSPRPLIQELSDEDPSGQPLMPPTCQRDAAPLTSTGDRDSDFLAASSPVPTESAATPPET
CVGVAQPSQALPTWDLTAFPAPKAS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 79.8 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_848547
Locus ID 123872
UniProt ID Q8NEP3, A0A140VJN4
Cytogenetics 16q24.1
Refseq Size 2451
Refseq ORF 2175
Synonyms CILD13; DAU1; LRRC50; ODA7; swt
Summary The protein encoded by this gene is cilium-specific and is required for the stability of the ciliary architecture. It is involved in the regulation of microtubule-based cilia and actin-based brush border microvilli. Mutations in this gene are associated with primary ciliary dyskinesia-13. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.