HCG3 (DNAJB3) (NM_001001394) Human Recombinant Protein

CAT#: TP305526

Recombinant protein of human DnaJ (Hsp40) homolog, subfamily B, member 3 (DNAJB3)

Product Images

Coomassie blue staining of purified DNAJB3 protein (Cat# TP305526). The protein was produced from HEK293T cells transfected with DNAJB3 cDNA clone (Cat# RC205526) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205526 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVDYYEVLDVPRQASSEAIKKAYRKLALKWHPDKNPENKEEAERRFKQVAEAYEVLSDAKKRDIYDRYGE
  AGAEGGCTGGRPFEDPFEYVFSFRDPADVFREFFGGQDPFSFDLLGNPLENILGGSEELLGKQKQSVCTP
  FLCLQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 16.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001001394
• Locus ID: 414061
• UniProt ID: Q8WWF6
• Cytogenetics: 2q37.1
• Refseq Size: 1266
• Refseq ORF: 435
• Synonyms: HCG3
• Summary: May operate as a co-chaperone of the male germ cell- and haploid stage-specific Hsp70 proteins.[UniProtKB/Swiss-Prot Function]