IFIT2 (NM_001547) Human Recombinant Protein

CAT#: TP305582

Recombinant protein of human interferon-induced protein with tetratricopeptide repeats 2 (IFIT2)

Product Images

Coomassie blue staining of purified IFIT2 protein (Cat# TP305582). The protein was produced from HEK293T cells transfected with IFIT2 cDNA clone (Cat# RC205582) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205582 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSENNKNSLESSLRQLKCHFTWNLMEGENSLDDFEDKVFYRTEFQNREFKATMCNLLAYLKHLKGQNEAA
  LECLRKAEELIQQEHADQAEIRSLVTWGNYAWVYYHMGRLSDVQIYVDKVRHVCEKFSSPYRIESPELDC
  EEGWTRLKCGGNQNERAKVCFEKALEKKPKNPEFTSGLAIASYRLDNWPPSQNAIDPLRQAIRLNPDNQY
  LKVLLALKLHKMREEGEEEGEGEKLVEEALEKAPGVTDVLRSAAKFYRRKDEPDKAIELLKKALEYIPNN
  AYLHCQIGCCYRAKVFQVMNLRENGMYGKRKLLELIGHAVAHLKKADEANDNLFRVCSILASLHALADQY
  EEAEYYFQKEFSKELTPVAKQLLHLRYGNFQLYQMKCEDKAIHHFIEGVKINQKSREKEKMKDKLQKIAK
  MRLSKNGADSEALHVLAFLQELNEKMQQADEDSERGLESGSLIPSASSWNGEWRIEMWCPLGYC
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 54.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001538
• Locus ID: 3433
• UniProt ID: P09913, Q05DN2
• Cytogenetics: 10q23.31
• Refseq Size: 3505
• Refseq ORF: 1452
• Synonyms: cig42; G10P2; GARG-39; IFI-54; IFI-54K; IFI54; IFIT-2; ISG-54 K; ISG-54K; ISG54; P54
• Summary: IFN-induced antiviral protein which inhibits expression of viral messenger RNAs lacking 2'-O-methylation of the 5' cap. The ribose 2'-O-methylation would provide a molecular signature to distinguish between self and non-self mRNAs by the host during viral infection. Viruses evolved several ways to evade this restriction system such as encoding their own 2'-O-methylase for their mRNAs or by stealing host cap containing the 2'-O-methylation (cap snatching mechanism). Binds AU-rich viral RNAs, with or without 5' triphosphorylation, RNA-binding is required for antiviral activity. Can promote apoptosis.[UniProtKB/Swiss-Prot Function]