C20orf11 (GID8) (NM_017896) Human Recombinant Protein
CAT#: TP305664
Recombinant protein of human chromosome 20 open reading frame 11 (C20orf11)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205664 protein sequence
Red=Cloning site Green=Tags(s) MSYAEKPDEITKDEWMEKLNNLHVQRADMNRLIMNYLVTEGFKEAAEKFRMESGIEPSLDLETLDERIKI REMILKGQIQEAIALINSLHPELLDTNRYLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESRECL TEMERTLALLAFDSPEESPFGDLLHTMQRQKVWSEVNQAVLDYENRESTPKLAKLLKLLLWAQNELDQKK VKYPKMTDLSKGVIEEPK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26.6 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060366 |
Locus ID | 54994 |
UniProt ID | Q9NWU2 |
Cytogenetics | 20q13.33 |
Refseq Size | 4440 |
Refseq ORF | 684 |
Synonyms | C20orf11; TWA1 |
Summary | Core component of the CTLH E3 ubiquitin-protein ligase complex that selectively accepts ubiquitin from UBE2H and mediates ubiquitination and subsequent proteasomal degradation of the transcription factor HBP1 (PubMed:29911972). Acts as a positive regulator of Wnt signaling pathway by promoting beta-catenin (CTNNB1) nuclear accumulation (PubMed:28829046).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413478 | GID8 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY413478 | Transient overexpression lysate of chromosome 20 open reading frame 11 (C20orf11) |
USD 396.00 |
|
PH305664 | C20orf11 MS Standard C13 and N15-labeled recombinant protein (NP_060366) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review