Rab9 (RAB9A) (NM_004251) Human Recombinant Protein
CAT#: TP305698
Recombinant protein of human RAB9A, member RAS oncogene family (RAB9A)
View other "RAB9A" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205698 protein sequence
Red=Cloning site Green=Tags(s) MAGKSSLFKVILLGDGGVGKSSLMNRYVTNKFDTQLFHTIGVEFLNKDLEVDGHFVTMQIWDTAGQERFR SLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPESFPFVILGNKIDISERQVSTEEAQA WCRDNGDYPYFETSAKDATNVAAAFEEAVRRVLATEDRSDHLIQTDTVNLHRKPKPSSSCC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.7 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004242 |
Locus ID | 9367 |
UniProt ID | P51151, A0A024RBV5 |
Cytogenetics | Xp22.2 |
Refseq Size | 1377 |
Refseq ORF | 603 |
Synonyms | RAB9 |
Summary | Involved in the transport of proteins between the endosomes and the trans Golgi network. Involved in the recruitment of SGSM2 to melanosomes and is required for the proper trafficking of melanogenic enzymes TYR, TYRP1 and DCT/TYRP2 to melanosomes in melanocytes.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401363 | RAB9A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401363 | Transient overexpression lysate of RAB9A, member RAS oncogene family (RAB9A) |
USD 396.00 |
|
PH305698 | RAB9A MS Standard C13 and N15-labeled recombinant protein (NP_004242) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review